RECQL purified MaxPab rabbit polyclonal antibody (D01P)
  • RECQL purified MaxPab rabbit polyclonal antibody (D01P)

RECQL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005965-D01P
RECQL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RECQL protein.
Información adicional
Size 100 ug
Gene Name RECQL
Gene Alias RECQL1|RecQ1
Gene Description RecQ protein-like (DNA helicase Q1-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RECQL (NP_002898.2, 1 a.a. ~ 649 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5965

Enviar un mensaje


RECQL purified MaxPab rabbit polyclonal antibody (D01P)

RECQL purified MaxPab rabbit polyclonal antibody (D01P)