RDX MaxPab rabbit polyclonal antibody (D01)
  • RDX MaxPab rabbit polyclonal antibody (D01)

RDX MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005962-D01
RDX MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RDX protein.
Información adicional
Size 100 uL
Gene Name RDX
Gene Alias DFNB24
Gene Description radixin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RDX (AAH47109.1, 1 a.a. ~ 583 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5962

Enviar un mensaje


RDX MaxPab rabbit polyclonal antibody (D01)

RDX MaxPab rabbit polyclonal antibody (D01)