RDX purified MaxPab mouse polyclonal antibody (B01P)
  • RDX purified MaxPab mouse polyclonal antibody (B01P)

RDX purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005962-B01P
RDX purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RDX protein.
Información adicional
Size 50 ug
Gene Name RDX
Gene Alias DFNB24
Gene Description radixin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RDX (AAH47109.1, 1 a.a. ~ 583 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5962

Enviar un mensaje


RDX purified MaxPab mouse polyclonal antibody (B01P)

RDX purified MaxPab mouse polyclonal antibody (B01P)