RCVRN MaxPab rabbit polyclonal antibody (D01)
  • RCVRN MaxPab rabbit polyclonal antibody (D01)

RCVRN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005957-D01
RCVRN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RCVRN protein.
Información adicional
Size 100 uL
Gene Name RCVRN
Gene Alias RCV1
Gene Description recoverin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RCVRN (NP_002894.1, 1 a.a. ~ 200 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5957

Enviar un mensaje


RCVRN MaxPab rabbit polyclonal antibody (D01)

RCVRN MaxPab rabbit polyclonal antibody (D01)