RBP4 monoclonal antibody (M03), clone 4E7
  • RBP4 monoclonal antibody (M03), clone 4E7

RBP4 monoclonal antibody (M03), clone 4E7

Ref: AB-H00005950-M03
RBP4 monoclonal antibody (M03), clone 4E7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RBP4.
Información adicional
Size 100 ug
Gene Name RBP4
Gene Alias -
Gene Description retinol binding protein 4, plasma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBP4 (AAH20633.1, 19 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5950
Clone Number 4E7
Iso type IgG1 Lambda

Enviar un mensaje


RBP4 monoclonal antibody (M03), clone 4E7

RBP4 monoclonal antibody (M03), clone 4E7