RBP4 purified MaxPab rabbit polyclonal antibody (D01P)
  • RBP4 purified MaxPab rabbit polyclonal antibody (D01P)

RBP4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005950-D01P
RBP4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RBP4 protein.
Información adicional
Size 100 ug
Gene Name RBP4
Gene Alias -
Gene Description retinol binding protein 4, plasma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RBP4 (NP_006735.2, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5950

Enviar un mensaje


RBP4 purified MaxPab rabbit polyclonal antibody (D01P)

RBP4 purified MaxPab rabbit polyclonal antibody (D01P)