RBM3 monoclonal antibody (M06), clone 4D6
  • RBM3 monoclonal antibody (M06), clone 4D6

RBM3 monoclonal antibody (M06), clone 4D6

Ref: AB-H00005935-M06
RBM3 monoclonal antibody (M06), clone 4D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBM3.
Información adicional
Size 100 ug
Gene Name RBM3
Gene Alias IS1-RNPL|RNPL
Gene Description RNA binding motif (RNP1, RRM) protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBM3 (NP_006734.1, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5935
Clone Number 4D6
Iso type IgG1 Kappa

Enviar un mensaje


RBM3 monoclonal antibody (M06), clone 4D6

RBM3 monoclonal antibody (M06), clone 4D6