RBL1 monoclonal antibody (M01), clone 1A5
  • RBL1 monoclonal antibody (M01), clone 1A5

RBL1 monoclonal antibody (M01), clone 1A5

Ref: AB-H00005933-M01
RBL1 monoclonal antibody (M01), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBL1.
Información adicional
Size 100 ug
Gene Name RBL1
Gene Alias CP107|MGC40006|PRB1|p107
Gene Description retinoblastoma-like 1 (p107)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,PLA-Ce
Immunogen Prot. Seq IDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBL1 (AAH32247, 905 a.a. ~ 1014 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5933
Clone Number 1A5
Iso type IgG1 Kappa

Enviar un mensaje


RBL1 monoclonal antibody (M01), clone 1A5

RBL1 monoclonal antibody (M01), clone 1A5