RBBP6 monoclonal antibody (M01), clone 5A11
  • RBBP6 monoclonal antibody (M01), clone 5A11

RBBP6 monoclonal antibody (M01), clone 5A11

Ref: AB-H00005930-M01
RBBP6 monoclonal antibody (M01), clone 5A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBBP6.
Información adicional
Size 100 ug
Gene Name RBBP6
Gene Alias DKFZp686P0638|DKFZp761B2423|MY038|P2P-R|PACT|RBQ-1|SNAMA
Gene Description retinoblastoma binding protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq SSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTAAVVQVGISRNQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBBP6 (NP_008841, 1582 a.a. ~ 1691 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5930
Clone Number 5A11
Iso type IgG1 Kappa

Enviar un mensaje


RBBP6 monoclonal antibody (M01), clone 5A11

RBBP6 monoclonal antibody (M01), clone 5A11