RBBP6 polyclonal antibody (A01)
  • RBBP6 polyclonal antibody (A01)

RBBP6 polyclonal antibody (A01)

Ref: AB-H00005930-A01
RBBP6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RBBP6.
Información adicional
Size 50 uL
Gene Name RBBP6
Gene Alias DKFZp686P0638|DKFZp761B2423|MY038|P2P-R|PACT|RBQ-1|SNAMA
Gene Description retinoblastoma binding protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTAAVVQVGISRNQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBBP6 (NP_008841, 1582 a.a. ~ 1691 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5930

Enviar un mensaje


RBBP6 polyclonal antibody (A01)

RBBP6 polyclonal antibody (A01)