JARID1A polyclonal antibody (A01)
  • JARID1A polyclonal antibody (A01)

JARID1A polyclonal antibody (A01)

Ref: AB-H00005927-A01
JARID1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant JARID1A.
Información adicional
Size 50 uL
Gene Name JARID1A
Gene Alias KDM5A|RBBP2|RBP2
Gene Description jumonji, AT rich interactive domain 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen JARID1A (NP_005047, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5927

Enviar un mensaje


JARID1A polyclonal antibody (A01)

JARID1A polyclonal antibody (A01)