RARRES3 purified MaxPab mouse polyclonal antibody (B01P)
  • RARRES3 purified MaxPab mouse polyclonal antibody (B01P)

RARRES3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005920-B01P
RARRES3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RARRES3 protein.
Información adicional
Size 50 ug
Gene Name RARRES3
Gene Alias HRASLS4|MGC8906|RIG1|TIG3
Gene Description retinoic acid receptor responder (tazarotene induced) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RARRES3 (AAH09678, 1 a.a. ~ 164 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5920

Enviar un mensaje


RARRES3 purified MaxPab mouse polyclonal antibody (B01P)

RARRES3 purified MaxPab mouse polyclonal antibody (B01P)