RARRES2 monoclonal antibody (M15), clone 3E3
  • RARRES2 monoclonal antibody (M15), clone 3E3

RARRES2 monoclonal antibody (M15), clone 3E3

Ref: AB-H00005919-M15
RARRES2 monoclonal antibody (M15), clone 3E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RARRES2.
Información adicional
Size 100 ug
Gene Name RARRES2
Gene Alias CHEMERIN|HP10433|TIG2
Gene Description retinoic acid receptor responder (tazarotene induced) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARRES2 (NP_002880.1, 17 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5919
Clone Number 3E3
Iso type IgG2a Kappa

Enviar un mensaje


RARRES2 monoclonal antibody (M15), clone 3E3

RARRES2 monoclonal antibody (M15), clone 3E3