RARRES2 MaxPab mouse polyclonal antibody (B01)
  • RARRES2 MaxPab mouse polyclonal antibody (B01)

RARRES2 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00005919-B01
RARRES2 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human RARRES2 protein.
Información adicional
Size 50 uL
Gene Name RARRES2
Gene Alias CHEMERIN|HP10433|TIG2
Gene Description retinoic acid receptor responder (tazarotene induced) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RARRES2 (NP_002880.1, 1 a.a. ~ 163 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5919

Enviar un mensaje


RARRES2 MaxPab mouse polyclonal antibody (B01)

RARRES2 MaxPab mouse polyclonal antibody (B01)