RARS monoclonal antibody (M01A), clone 1E9-2B5
  • RARS monoclonal antibody (M01A), clone 1E9-2B5

RARS monoclonal antibody (M01A), clone 1E9-2B5

Ref: AB-H00005917-M01A
RARS monoclonal antibody (M01A), clone 1E9-2B5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RARS.
Información adicional
Size 200 uL
Gene Name RARS
Gene Alias ArgRS|DALRD1|MGC8641
Gene Description arginyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARS (AAH00528, 1 a.a. ~ 660 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5917
Clone Number 1E9-2B5
Iso type IgM Kappa

Enviar un mensaje


RARS monoclonal antibody (M01A), clone 1E9-2B5

RARS monoclonal antibody (M01A), clone 1E9-2B5