RARS MaxPab rabbit polyclonal antibody (D01)
  • RARS MaxPab rabbit polyclonal antibody (D01)

RARS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005917-D01
RARS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RARS protein.
Información adicional
Size 100 uL
Gene Name RARS
Gene Alias ArgRS|DALRD1|MGC8641
Gene Description arginyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RARS (NP_002878.2, 1 a.a. ~ 660 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5917

Enviar un mensaje


RARS MaxPab rabbit polyclonal antibody (D01)

RARS MaxPab rabbit polyclonal antibody (D01)