RARG polyclonal antibody (A01)
  • RARG polyclonal antibody (A01)

RARG polyclonal antibody (A01)

Ref: AB-H00005916-A01
RARG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RARG.
Información adicional
Size 50 uL
Gene Name RARG
Gene Alias NR1B3|RARC
Gene Description retinoic acid receptor, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARG (AAH19098, 43 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5916

Enviar un mensaje


RARG polyclonal antibody (A01)

RARG polyclonal antibody (A01)