RARA purified MaxPab mouse polyclonal antibody (B01P)
  • RARA purified MaxPab mouse polyclonal antibody (B01P)

RARA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005914-B01P
RARA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RARA protein.
Información adicional
Size 50 ug
Gene Name RARA
Gene Alias NR1B1|RAR
Gene Description retinoic acid receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RARA (ABM84670.1, 1 a.a. ~ 462 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5914

Enviar un mensaje


RARA purified MaxPab mouse polyclonal antibody (B01P)

RARA purified MaxPab mouse polyclonal antibody (B01P)