RAPSN polyclonal antibody (A01)
  • RAPSN polyclonal antibody (A01)

RAPSN polyclonal antibody (A01)

Ref: AB-H00005913-A01
RAPSN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAPSN.
Información adicional
Size 50 uL
Gene Name RAPSN
Gene Alias CMS1D|CMS1E|MGC3597|RNF205
Gene Description receptor-associated protein of the synapse
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAPSN (NP_005046, 313 a.a. ~ 412 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5913

Enviar un mensaje


RAPSN polyclonal antibody (A01)

RAPSN polyclonal antibody (A01)