RAP2A polyclonal antibody (A01)
  • RAP2A polyclonal antibody (A01)

RAP2A polyclonal antibody (A01)

Ref: AB-H00005911-A01
RAP2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RAP2A.
Información adicional
Size 50 uL
Gene Name RAP2A
Gene Alias K-REV|KREV|RAP2|RbBP-30
Gene Description RAP2A, member of RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAP2A (AAH41333, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5911

Enviar un mensaje


RAP2A polyclonal antibody (A01)

RAP2A polyclonal antibody (A01)