RALGDS monoclonal antibody (M01), clone 1A11
  • RALGDS monoclonal antibody (M01), clone 1A11

RALGDS monoclonal antibody (M01), clone 1A11

Ref: AB-H00005900-M01
RALGDS monoclonal antibody (M01), clone 1A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RALGDS.
Información adicional
Size 100 ug
Gene Name RALGDS
Gene Alias FLJ20922|RGF|RalGEF
Gene Description ral guanine nucleotide dissociation stimulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq SLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RALGDS (AAH59362, 793 a.a. ~ 902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5900
Clone Number 1A11
Iso type IgG1 Kappa

Enviar un mensaje


RALGDS monoclonal antibody (M01), clone 1A11

RALGDS monoclonal antibody (M01), clone 1A11