RALGDS polyclonal antibody (A01)
  • RALGDS polyclonal antibody (A01)

RALGDS polyclonal antibody (A01)

Ref: AB-H00005900-A01
RALGDS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RALGDS.
Información adicional
Size 50 uL
Gene Name RALGDS
Gene Alias FLJ20922|RGF|RalGEF
Gene Description ral guanine nucleotide dissociation stimulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RALGDS (AAH59362, 793 a.a. ~ 902 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5900

Enviar un mensaje


RALGDS polyclonal antibody (A01)

RALGDS polyclonal antibody (A01)