RALB monoclonal antibody (M04), clone 4D1
  • RALB monoclonal antibody (M04), clone 4D1

RALB monoclonal antibody (M04), clone 4D1

Ref: AB-H00005899-M04
RALB monoclonal antibody (M04), clone 4D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RALB.
Información adicional
Size 100 ug
Gene Name RALB
Gene Alias -
Gene Description v-ral simian leukemia viral oncogene homolog B (ras related
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA
Immunogen Prot. Seq FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RALB (AAH18163, 89 a.a. ~ 183 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5899
Clone Number 4D1
Iso type IgG2a Kappa

Enviar un mensaje


RALB monoclonal antibody (M04), clone 4D1

RALB monoclonal antibody (M04), clone 4D1