RAG2 monoclonal antibody (M06), clone 2G8
  • RAG2 monoclonal antibody (M06), clone 2G8

RAG2 monoclonal antibody (M06), clone 2G8

Ref: AB-H00005897-M06
RAG2 monoclonal antibody (M06), clone 2G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAG2.
Información adicional
Size 100 ug
Gene Name RAG2
Gene Alias RAG-2
Gene Description recombination activating gene 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAG2 (NP_000527.1, 428 a.a. ~ 527 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5897
Clone Number 2G8
Iso type IgG2b Kappa

Enviar un mensaje


RAG2 monoclonal antibody (M06), clone 2G8

RAG2 monoclonal antibody (M06), clone 2G8