RAF1 polyclonal antibody (A01)
  • RAF1 polyclonal antibody (A01)

RAF1 polyclonal antibody (A01)

Ref: AB-H00005894-A01
RAF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAF1.
Información adicional
Size 50 uL
Gene Name RAF1
Gene Alias CRAF|NS5|Raf-1|c-Raf
Gene Description v-raf-1 murine leukemia viral oncogene homolog 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAF1 (AAH18119, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5894

Enviar un mensaje


RAF1 polyclonal antibody (A01)

RAF1 polyclonal antibody (A01)