RAD51L3 monoclonal antibody (M02), clone 1C8-3C12
  • RAD51L3 monoclonal antibody (M02), clone 1C8-3C12

RAD51L3 monoclonal antibody (M02), clone 1C8-3C12

Ref: AB-H00005892-M02
RAD51L3 monoclonal antibody (M02), clone 1C8-3C12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RAD51L3.
Información adicional
Size 100 ug
Gene Name RAD51L3
Gene Alias HsTRAD|R51H3|RAD51D|Trad
Gene Description RAD51-like 3 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAD51L3 (AAH14422, 1 a.a. ~ 328 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5892
Clone Number 1C8-3C12
Iso type IgG1 Kappa

Enviar un mensaje


RAD51L3 monoclonal antibody (M02), clone 1C8-3C12

RAD51L3 monoclonal antibody (M02), clone 1C8-3C12