RAC3 purified MaxPab rabbit polyclonal antibody (D01P)
  • RAC3 purified MaxPab rabbit polyclonal antibody (D01P)

RAC3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005881-D01P
RAC3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAC3 protein.
Información adicional
Size 100 ug
Gene Name RAC3
Gene Alias -
Gene Description ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAC3 (NP_005043.1, 1 a.a. ~ 192 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5881

Enviar un mensaje


RAC3 purified MaxPab rabbit polyclonal antibody (D01P)

RAC3 purified MaxPab rabbit polyclonal antibody (D01P)