RAB4A purified MaxPab mouse polyclonal antibody (B01P)
  • RAB4A purified MaxPab mouse polyclonal antibody (B01P)

RAB4A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005867-B01P
RAB4A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB4A protein.
Información adicional
Size 50 ug
Gene Name RAB4A
Gene Alias HRES-1/RAB4|RAB4
Gene Description RAB4A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB4A (NP_004569.2, 1 a.a. ~ 218 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5867

Enviar un mensaje


RAB4A purified MaxPab mouse polyclonal antibody (B01P)

RAB4A purified MaxPab mouse polyclonal antibody (B01P)