RAB3B purified MaxPab mouse polyclonal antibody (B02P)
  • RAB3B purified MaxPab mouse polyclonal antibody (B02P)

RAB3B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00005865-B02P
RAB3B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB3B protein.
Información adicional
Size 50 ug
Gene Name RAB3B
Gene Alias -
Gene Description RAB3B, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB3B (NP_002858.2, 1 a.a. ~ 219 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5865

Enviar un mensaje


RAB3B purified MaxPab mouse polyclonal antibody (B02P)

RAB3B purified MaxPab mouse polyclonal antibody (B02P)