RAB3A polyclonal antibody (A03)
  • RAB3A polyclonal antibody (A03)

RAB3A polyclonal antibody (A03)

Ref: AB-H00005864-A03
RAB3A polyclonal antibody (A03)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAB3A.
Información adicional
Size 50 uL
Gene Name RAB3A
Gene Alias -
Gene Description RAB3A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB3A (NP_002857, 122 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5864

Enviar un mensaje


RAB3A polyclonal antibody (A03)

RAB3A polyclonal antibody (A03)