RGL2 monoclonal antibody (M02), clone 4D10
  • RGL2 monoclonal antibody (M02), clone 4D10

RGL2 monoclonal antibody (M02), clone 4D10

Ref: AB-H00005863-M02
RGL2 monoclonal antibody (M02), clone 4D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RGL2.
Información adicional
Size 100 ug
Gene Name RGL2
Gene Alias HKE1.5|KE1.5|RAB2L
Gene Description ral guanine nucleotide dissociation stimulator-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGL2 (AAH32681, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5863
Clone Number 4D10
Iso type IgG1

Enviar un mensaje


RGL2 monoclonal antibody (M02), clone 4D10

RGL2 monoclonal antibody (M02), clone 4D10