PXMP3 polyclonal antibody (A01)
  • PXMP3 polyclonal antibody (A01)

PXMP3 polyclonal antibody (A01)

Ref: AB-H00005828-A01
PXMP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PXMP3.
Información adicional
Size 50 uL
Gene Name PXMP3
Gene Alias PAF-1|PAF1|PEX2|PMP3|PMP35|RNF72
Gene Description peroxisomal membrane protein 3, 35kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PXMP3 (NP_000309, 217 a.a. ~ 305 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5828

Enviar un mensaje


PXMP3 polyclonal antibody (A01)

PXMP3 polyclonal antibody (A01)