PEX19 purified MaxPab mouse polyclonal antibody (B01P)
  • PEX19 purified MaxPab mouse polyclonal antibody (B01P)

PEX19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005824-B01P
PEX19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PEX19 protein.
Información adicional
Size 50 ug
Gene Name PEX19
Gene Alias D1S2223E|HK33|PMP1|PMPI|PXF|PXMP1
Gene Description peroxisomal biogenesis factor 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PEX19 (NP_002848.1, 1 a.a. ~ 299 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5824

Enviar un mensaje


PEX19 purified MaxPab mouse polyclonal antibody (B01P)

PEX19 purified MaxPab mouse polyclonal antibody (B01P)