PWP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PWP2 purified MaxPab rabbit polyclonal antibody (D01P)

PWP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005822-D01P
PWP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PWP2 protein.
Información adicional
Size 100 ug
Gene Name PWP2
Gene Alias EHOC-17|PWP2H
Gene Description PWP2 periodic tryptophan protein homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKFAYRFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTVFDLKNNKSDTLPLATRYNVKCVGLSPDGRLAIIVDEGGDALLVSLVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLIYYALGGHKDAIVACFFESNSLDLYSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQREEEEEEEEDQEGDRET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PWP2 (NP_005040.2, 1 a.a. ~ 919 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5822

Enviar un mensaje


PWP2 purified MaxPab rabbit polyclonal antibody (D01P)

PWP2 purified MaxPab rabbit polyclonal antibody (D01P)