PVRL2 purified MaxPab mouse polyclonal antibody (B01P)
  • PVRL2 purified MaxPab mouse polyclonal antibody (B01P)

PVRL2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005819-B01P
PVRL2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PVRL2 protein.
Información adicional
Size 50 ug
Gene Name PVRL2
Gene Alias CD112|HVEB|PRR2|PVRR2
Gene Description poliovirus receptor-related 2 (herpesvirus entry mediator B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P
Immunogen Prot. Seq MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PVRL2 (NP_002847.1, 1 a.a. ~ 479 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5819

Enviar un mensaje


PVRL2 purified MaxPab mouse polyclonal antibody (B01P)

PVRL2 purified MaxPab mouse polyclonal antibody (B01P)