PVRL1 MaxPab rabbit polyclonal antibody (D01)
  • PVRL1 MaxPab rabbit polyclonal antibody (D01)

PVRL1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005818-D01
PVRL1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PVRL1 protein.
Información adicional
Size 100 uL
Gene Name PVRL1
Gene Alias CD111|CLPED1|ED4|HIgR|HVEC|MGC142031|MGC16207|OFC7|PRR|PRR1|PVRR|PVRR1|SK-12|nectin-1
Gene Description poliovirus receptor-related 1 (herpesvirus entry mediator C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEGFD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PVRL1 (NP_976031.1, 1 a.a. ~ 352 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5818

Enviar un mensaje


PVRL1 MaxPab rabbit polyclonal antibody (D01)

PVRL1 MaxPab rabbit polyclonal antibody (D01)