PVRL1 polyclonal antibody (A01)
  • PVRL1 polyclonal antibody (A01)

PVRL1 polyclonal antibody (A01)

Ref: AB-H00005818-A01
PVRL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PVRL1.
Información adicional
Size 50 uL
Gene Name PVRL1
Gene Alias CD111|CLPED1|ED4|HIgR|HVEC|MGC142031|MGC16207|OFC7|PRR|PRR1|PVRR|PVRR1|SK-12|nectin-1
Gene Description poliovirus receptor-related 1 (herpesvirus entry mediator C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq VQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PVRL1 (NP_002846, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5818

Enviar un mensaje


PVRL1 polyclonal antibody (A01)

PVRL1 polyclonal antibody (A01)