PVR polyclonal antibody (A01)
  • PVR polyclonal antibody (A01)

PVR polyclonal antibody (A01)

Ref: AB-H00005817-A01
PVR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PVR.
Información adicional
Size 50 uL
Gene Name PVR
Gene Alias CD155|FLJ25946|HVED|NECL5|Necl-5|PVS|TAGE4
Gene Description poliovirus receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq QAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PVR (NP_006496, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5817

Enviar un mensaje


PVR polyclonal antibody (A01)

PVR polyclonal antibody (A01)