RAD1 monoclonal antibody (M01C), clone 1G2
  • RAD1 monoclonal antibody (M01C), clone 1G2

RAD1 monoclonal antibody (M01C), clone 1G2

Ref: AB-H00005810-M01C
RAD1 monoclonal antibody (M01C), clone 1G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAD1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name RAD1
Gene Alias HRAD1|REC1
Gene Description RAD1 homolog (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAD1 (AAH06837, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 5810
Clone Number 1G2
Iso type IgG3 Kappa

Enviar un mensaje


RAD1 monoclonal antibody (M01C), clone 1G2

RAD1 monoclonal antibody (M01C), clone 1G2