PTX3 monoclonal antibody (M01), clone 5B7
  • PTX3 monoclonal antibody (M01), clone 5B7

PTX3 monoclonal antibody (M01), clone 5B7

Ref: AB-H00005806-M01
PTX3 monoclonal antibody (M01), clone 5B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTX3.
Información adicional
Size 100 ug
Gene Name PTX3
Gene Alias TNFAIP5|TSG-14
Gene Description pentraxin-related gene, rapidly induced by IL-1 beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTX3 (NP_002843, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5806
Clone Number 5B7
Iso type IgG1 Kappa

Enviar un mensaje


PTX3 monoclonal antibody (M01), clone 5B7

PTX3 monoclonal antibody (M01), clone 5B7