PTPRN purified MaxPab rabbit polyclonal antibody (D01P)
  • PTPRN purified MaxPab rabbit polyclonal antibody (D01P)

PTPRN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005798-D01P
PTPRN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTPRN protein.
Información adicional
Size 100 ug
Gene Name PTPRN
Gene Alias FLJ16131|IA-2|IA-2/PTP|IA2|ICA512|R-PTP-N
Gene Description protein tyrosine phosphatase, receptor type, N
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFGQCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPEPRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAELLPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTPRN (AAH70053.1, 1 a.a. ~ 950 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5798

Enviar un mensaje


PTPRN purified MaxPab rabbit polyclonal antibody (D01P)

PTPRN purified MaxPab rabbit polyclonal antibody (D01P)