PTPRF polyclonal antibody (A01)
  • PTPRF polyclonal antibody (A01)

PTPRF polyclonal antibody (A01)

Ref: AB-H00005792-A01
PTPRF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTPRF.
Información adicional
Size 50 uL
Gene Name PTPRF
Gene Alias FLJ43335|FLJ45062|FLJ45567|LAR
Gene Description protein tyrosine phosphatase, receptor type, F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPRF (NP_002831, 1788 a.a. ~ 1897 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5792

Enviar un mensaje


PTPRF polyclonal antibody (A01)

PTPRF polyclonal antibody (A01)