PTPRE monoclonal antibody (M04), clone 2D10
  • PTPRE monoclonal antibody (M04), clone 2D10

PTPRE monoclonal antibody (M04), clone 2D10

Ref: AB-H00005791-M04
PTPRE monoclonal antibody (M04), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTPRE.
Información adicional
Size 100 ug
Gene Name PTPRE
Gene Alias DKFZp313F1310|FLJ57799|FLJ58245|HPTPE|PTPE|R-PTP-EPSILON
Gene Description protein tyrosine phosphatase, receptor type, E
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5791
Clone Number 2D10
Iso type IgG2a Kappa

Enviar un mensaje


PTPRE monoclonal antibody (M04), clone 2D10

PTPRE monoclonal antibody (M04), clone 2D10