PTPRE polyclonal antibody (A01)
  • PTPRE polyclonal antibody (A01)

PTPRE polyclonal antibody (A01)

Ref: AB-H00005791-A01
PTPRE polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTPRE.
Información adicional
Size 50 uL
Gene Name PTPRE
Gene Alias DKFZp313F1310|FLJ57799|FLJ58245|HPTPE|PTPE|R-PTP-EPSILON
Gene Description protein tyrosine phosphatase, receptor type, E
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5791

Enviar un mensaje


PTPRE polyclonal antibody (A01)

PTPRE polyclonal antibody (A01)