PTPRC monoclonal antibody (M12), clone 3D3
  • PTPRC monoclonal antibody (M12), clone 3D3

PTPRC monoclonal antibody (M12), clone 3D3

Ref: AB-H00005788-M12
PTPRC monoclonal antibody (M12), clone 3D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTPRC.
Información adicional
Size 100 ug
Gene Name PTPRC
Gene Alias B220|CD45|CD45R|GP180|LCA|LY5|T200
Gene Description protein tyrosine phosphatase, receptor type, C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPRC (NP_002829.2, 390 a.a. ~ 570 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5788
Clone Number 3D3
Iso type IgG2a Kappa

Enviar un mensaje


PTPRC monoclonal antibody (M12), clone 3D3

PTPRC monoclonal antibody (M12), clone 3D3