PTPN9 monoclonal antibody (M04), clone 2F12
  • PTPN9 monoclonal antibody (M04), clone 2F12

PTPN9 monoclonal antibody (M04), clone 2F12

Ref: AB-H00005780-M04
PTPN9 monoclonal antibody (M04), clone 2F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTPN9.
Información adicional
Size 100 ug
Gene Name PTPN9
Gene Alias MEG2|PTPMEG2
Gene Description protein tyrosine phosphatase, non-receptor type 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPN9 (NP_002824.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5780
Clone Number 2F12
Iso type IgG2a Kappa

Enviar un mensaje


PTPN9 monoclonal antibody (M04), clone 2F12

PTPN9 monoclonal antibody (M04), clone 2F12