QSOX1 purified MaxPab mouse polyclonal antibody (B01P)
  • QSOX1 purified MaxPab mouse polyclonal antibody (B01P)

QSOX1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005768-B01P
QSOX1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human QSOX1 protein.
Información adicional
Size 50 ug
Gene Name QSOX1
Gene Alias FLJ34858|Q6|QSCN6
Gene Description quiescin Q6 sulfhydryl oxidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLAREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen QSOX1 (ADZ16009.1, 1 a.a. ~ 604 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5768

Enviar un mensaje


QSOX1 purified MaxPab mouse polyclonal antibody (B01P)

QSOX1 purified MaxPab mouse polyclonal antibody (B01P)