PTK6 monoclonal antibody (M01), clone 2F11
  • PTK6 monoclonal antibody (M01), clone 2F11

PTK6 monoclonal antibody (M01), clone 2F11

Ref: AB-H00005753-M01
PTK6 monoclonal antibody (M01), clone 2F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTK6.
Información adicional
Size 100 ug
Gene Name PTK6
Gene Alias BRK|FLJ42088
Gene Description PTK6 protein tyrosine kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,ELISA
Immunogen Prot. Seq YLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTK6 (NP_005966, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5753
Clone Number 2F11
Iso type IgG2b Kappa

Enviar un mensaje


PTK6 monoclonal antibody (M01), clone 2F11

PTK6 monoclonal antibody (M01), clone 2F11