PTK6 purified MaxPab mouse polyclonal antibody (B01P)
  • PTK6 purified MaxPab mouse polyclonal antibody (B01P)

PTK6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005753-B01P
PTK6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTK6 protein.
Información adicional
Size 50 ug
Gene Name PTK6
Gene Alias BRK|FLJ42088
Gene Description PTK6 protein tyrosine kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTK6 (NP_005966.1, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5753

Enviar un mensaje


PTK6 purified MaxPab mouse polyclonal antibody (B01P)

PTK6 purified MaxPab mouse polyclonal antibody (B01P)