PTK2 polyclonal antibody (A01)
  • PTK2 polyclonal antibody (A01)

PTK2 polyclonal antibody (A01)

Ref: AB-H00005747-A01
PTK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTK2.
Información adicional
Size 50 uL
Gene Name PTK2
Gene Alias FADK|FAK|FAK1|pp125FAK
Gene Description PTK2 protein tyrosine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTK2 (AAH28733, 355 a.a. ~ 490 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5747

Enviar un mensaje


PTK2 polyclonal antibody (A01)

PTK2 polyclonal antibody (A01)